UCHL5 Antibody - middle region : HRP

UCHL5 Antibody - middle region : HRP
SKU
AVIARP56797_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human UCHL5

Key Reference: Qiu,X.B., (2006) EMBO J. 25 (24), 5742-5753

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ubiquitin carboxyl-terminal hydrolase isozyme L5

Protein Size: 329

Purification: Affinity Purified
More Information
SKU AVIARP56797_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56797_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51377
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×