Urgcp Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Urgcp may be involved in cell cycle progression through the regulation of cyclin D1 expression.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: YGDGTNEAQDNDFPTVERSRLQEMLSLLGLETYQAQKLTLQDSLQISFDS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Up-regulator of cell proliferation

Protein Size: 883

Purification: Affinity Purified

• SKU: AVIARP56287_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56287_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 72046
• Host: Rabbit