USP22 Antibody - middle region : Biotin

USP22 Antibody - middle region : Biotin
SKU
AVIARP58353_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP22

Key Reference: Zhang,X.Y., (2008) Mol. Cell 29 (1), 102-111

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: PSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 22

Protein Size: 525

Purification: Affinity Purified
More Information
SKU AVIARP58353_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58353_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23326
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×