USP22 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: USP22 is a subunit of the SAGA transcriptional cofactor complex. It deubiquitylates histone H2B and is recruited to specific genes by activators like Myc. USP22 is needed for cell cycle progression. It deubiquitylates histone H2A in addition to H2B. Altered mRNA expression is associated with therapy failure and death in patients multiple types of cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP22

Key Reference: Zhang,X.Y., (2008) Mol. Cell 29 (1), 102-111

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: RLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 22

Protein Size: 525

Purification: Affinity Purified

• SKU: AVIARP58352_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58352_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23326
• Host: Rabbit
• Conjugate: Conjugated, Biotin