USP36 Antibody - N-terminal region : Biotin

USP36 Antibody - N-terminal region : Biotin
SKU
AVIARP57666_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human USP36

Molecular Weight: 123kDa

Peptide Sequence: Synthetic peptide located within the following region: SRHKSGDDPPARRQGSEHTYESCGDGVPAPQKVLFPTERLSLRWERVFRV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin carboxyl-terminal hydrolase 36

Protein Size: 1123

Purification: Affinity Purified
More Information
SKU AVIARP57666_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57666_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57602
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×