USP36 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Modification of cellular proteins by ubiquitin is an essential regulatory mechanism controlled by the coordinated action of multiple ubiquitin-conjugating and deubiquitinating enzymes. USP36 belongs to a large family of cysteine proteases that function as deubiquitinating enzymes (Quesada et al., 2004 [PubMed 14715245]).[supplied by OMIM, Jan 2009]

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human USP36

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KLKEALKPGRKDSADDGELGKLLASSAKKVLLQKIEFEPASKSFSYQLEA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ubiquitin carboxyl-terminal hydrolase 36

Protein Size: 285

Purification: Affinity Purified

• SKU: AVIARP57665_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57665_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57602
• Host: Rabbit