UTY Antibody : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a protein containing tetratricopeptide repeats which are thought to be involved in protein-protein interactions. The encoded protein is also a minor histocompatibility antigen which may induce graft rejection of male stem cell grafts. A large number of alternatively spliced transcripts have been observed for this gene, but the full length nature of some of these variants has not been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Molecular Weight: 150 kDa

Peptide Sequence: Synthetic peptide located within the following region: YKSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone demethylase UTY

Protein Size: 1347

Purification: Affinity Purified

• SKU: AVIARP58214_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58214_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Human Gene ID: 7404
• Host: Rabbit