VEGFB Antibody - middle region : Biotin

VEGFB Antibody - middle region : Biotin
SKU
AVIARP58975_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Vascular endothelial growth factor B (VEGFB) signals via the endothelial receptor VEGFR1 (MIM 165070) and is a regulator of blood vessel physiology, with a role in endothelial targeting of lipids to peripheral tissues (summarized by Hagberg et al., 2010 [PubMed 20228789]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VEGFB

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDRAAT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vascular endothelial growth factor B

Protein Size: 207

Purification: Affinity Purified
More Information
SKU AVIARP58975_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58975_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 7423
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×