VPS37C Antibody - N-terminal region : Biotin

VPS37C Antibody - N-terminal region : Biotin
SKU
AVIARP57073_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS37C

Key Reference: Eastman,S.W., (2005) J. Biol. Chem. 280 (1), 628-636

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 37C

Protein Size: 355

Purification: Affinity Purified
More Information
SKU AVIARP57073_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57073_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55048
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×