VPS54 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi. This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54

Key Reference: Liewen,H., (2005) Exp. Cell Res. 306 (1), 24-34

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: FNSVLPWSHFNTAGGKGNRDAASSKLLQEKLSHYLDIVEVNIAHQISLRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 54

Protein Size: 977

Purification: Affinity Purified

• SKU: AVIARP56168_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56168_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51542
• Host: Rabbit