VTA1 Antibody - N-terminal region : Biotin

VTA1 Antibody - N-terminal region : Biotin
SKU
AVIARP56921_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VTA1

Key Reference: Ward,D.M., (2005) J. Biol. Chem. 280 (11), 10548-10555

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein VTA1 homolog

Protein Size: 307

Purification: Affinity Purified
More Information
SKU AVIARP56921_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56921_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51534
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×