VTCN1 Antibody - N-terminal region : FITC

VTCN1 Antibody - N-terminal region : FITC
SKU
AVIARP59079_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein belonging to the B7 costimulatory protein family. Proteins in this family are present on the surface of antigen-presenting cells and interact with ligand bound to receptors on the surface of T cells. Studies have shown that high levels of the encoded protein has been correlated with tumor progression. A pseudogene of this gene is located on chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human VTCN1

Key Reference: N/A

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-set domain-containing T-cell activation inhibitor 1

Protein Size: 282

Purification: Affinity purified
More Information
SKU AVIARP59079_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59079_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79679
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×