WDR77 Antibody - N-terminal region : HRP

WDR77 Antibody - N-terminal region : HRP
SKU
AVIARP58692_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation. The 20S PRMT5-containing methyltransferase complex also methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDR77

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Methylosome protein 50

Protein Size: 342

Purification: Affinity Purified
More Information
SKU AVIARP58692_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58692_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 79084
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×