Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 1308-1436
Amino Acid Sequence: MHHHHHHIRATNYVESNWKKQCKELVNLIFQCEDSEPFRQPVDLVEYPDYRDIIDTPMDFGTVRETLDAGNYDSPLEFCKDIRLIFSNAKAYTPNKRSKIYSMTLRLSALFEEKMKKISSDFKIGQKFNEKLRRSQ
Applications: Useful for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling.
Description: Human bromodomain and WD repeat domain containing 1 (BRWD1) or WDR9, GenBank Accession No. NM_018963, a.a. 1308 - 1436 corresponding to bromodomain 2 with N-terminal His-tag, MW = 16.2 kDa, expressed in an E. coli expression system.
Format: Aqueous buffer solution
Formulation: 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 0.04 % Tween-20, 20% glycerol
Genbank: NM_018963
Storage Stability: At least 6 months at -80°C.
Tags: N-terminal His-tag
Uniprot: Q9NSI6
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Ramos, VC., et al., Biochim Biophys Acta. 2002 Sep 27;1577(3): 377-83
2. Huang, H., et al., Dev Dyn. 2003 Aug; 227(4): 608-14