WNT3A Antibody - N-terminal region : FITC

WNT3A Antibody - N-terminal region : FITC
SKU
AVIARP58818_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryog

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WNT3A

Key Reference: Chiquet,B.T., (er) Hum. Mol. Genet. (2008) In press

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wnt-3a

Protein Size: 352

Purification: Affinity Purified
More Information
SKU AVIARP58818_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58818_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 89780
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×