ZNF224 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Matrix-assisted laser desorption ionization-time of flight analysis and examination of protein profiles from the SwissProt database revealed that the previously defined p97 repressor is ZNF224, a zinc finger protein. ZNF224, a Kruppel-like zinc finger transcription factor, is the repressor protein that specifically binds to the negative cis-element AldA-NRE and affects the AldA-NRE-mediated transcription.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF224

Molecular Weight: 82

Peptide Sequence: Synthetic peptide located within the following region: SGEKPFKCEECGKGFYTNSQCYSHQRSHSGEKPYKCVECGKGYKRRLDLD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 224

Protein Size: 707

Purification: Affinity Purified

• SKU: AVIARP58369_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58369_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 7767
• Host: Rabbit
• Conjugate: Conjugated, HRP