ZNF44 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ZNF44 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF44

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: NLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 44

Protein Size: 589

Purification: Affinity Purified

• SKU: AVIARP58043_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58043_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51710
• Host: Rabbit