ABHD7 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of ABHD7 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epoxide hydrolase 4

Protein Size: 362

Purification: Affinity Purified

• SKU: AVIARP55651_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55651_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 253152
• Host: Rabbit