ABRAXAS2 Antibody - middle region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: BRISC complex subunit Abraxas 2

Protein Size: 415

Purification: Affinity Purified

Subunit: Abro1

• SKU: AVIARP55402_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55402_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23172
• Host: Rabbit