ABRAXAS2 Antibody - middle region : HRP

ABRAXAS2 Antibody - middle region : HRP
SKU
AVIARP55402_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KIAA0157

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: BRISC complex subunit Abraxas 2

Protein Size: 415

Purification: Affinity Purified

Subunit: Abro1
More Information
SKU AVIARP55402_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55402_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23172
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×