ACADVL Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Very long-chain specific acyl-CoA dehydrogenase, mitochondrial

Protein Size: 633

Purification: Affinity Purified

• SKU: AVIARP54487_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54487_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 37
• Host: Rabbit