ACOT11 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ACOT11 is a protein with acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Expression of a similar murine protein in brown adipose tissue is induced by cold exposure and repressed by warmth. Expression of the mouse protein has been associated with obesity, with higher expression found in obesity-resistant mice compared with obesity-prone mice.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACOT11

Molecular Weight: 65

Peptide Sequence: Synthetic peptide located within the following region: AEKTRVESVELVLPPHANHQGNTFGGQIMAWMENVATIAASRLCRAHPTL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-coenzyme A thioesterase 11

Protein Size: 594

Purification: Affinity Purified

• SKU: AVIARP55280_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55280_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26027
• Host: Rabbit