ACOT4 Antibody - middle region : Biotin

ACOT4 Antibody - middle region : Biotin
SKU
AVIARP58412_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH By similarity. Succinyl-CoA thioesterase that also hydrolyzes long chain saturated and unsaturated monocarboxylic acyl-CoAs.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ACOT4

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: NALV
GGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAH


Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-coenzyme A thioesterase 4

Protein Size: 421

Purification: Affinity Purified
More Information
SKU AVIARP58412_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58412_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 122970
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×