ACRBP Antibody - N-terminal region : FITC

ACRBP Antibody - N-terminal region : FITC
SKU
AVIARP58581_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACRBP

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acrosin-binding protein

Protein Size: 543

Purification: Affinity Purified
More Information
SKU AVIARP58581_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58581_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84519
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×