Target: Alpha Synuclein: ATTO 594
Nature: Recombinant
Swiss-Prot: P37840
Biological Activity: Under Investigation
Expression System: E. coli
Protein Length: Full Length
Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG
Purification: Ion-exchange Purified
Purity: >95%
Storage Buffer: PBS pH7.4, 0.09% Azide
Protein Size: N/A
Conjugate: ATTO 594
Cellular Localization: Cytoplasm,Membrane,Nucleus
Scientific Background: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).
References: 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013).2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.
Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.