Alpha Synuclein Pre-formed Fibrils: ATTO 594 (Type 1)

Human Recombinant Alpha Synuclein Protein Pre-formed Fibrils: ATTO 594 (Type 1)
SKU
STRSPR-322E-A594
Packaging Unit
100 µg x5
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: Alpha Synuclein.

Nature: Recombinant.

Swiss-Prot: P37840.

Biological Activity: Under Investigation.

Expression System: E. coli.

Protein Length: Full Length.

Amino Acid Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAG.

Purification: Ion-exchange Purified.

Purity: >95%.

Storage Buffer: PBS pH7.4, 0.09% Azide.

Conjugate: ATTO 594.

Cellular Localization: Cytoplasm, Membrane, Nucleus.

Scientific Background: Alpha-Synuclein (SNCA) is expressed predominantly in the brain, where it is concentrated in presynaptic nerve terminals (1). Alpha-synuclein is highly expressed in the mitochondria of the olfactory bulb, hippocampus, striatum and thalamus (2). Functionally, it has been shown to significantly interact with tubulin (3), and may serve as a potential microtubule-associated protein. It has also been found to be essential for normal development of the cognitive functions; inactivation may lead to impaired spatial learning and working memory (4). SNCA fibrillar aggregates represent the major non A-beta component of Alzheimers disease amyloid plaque, and a major component of Lewy body inclusions, and Parkinson's disease. Parkinson's disease (PD) is a common neurodegenerative disorder characterized by the progressive accumulation in selected neurons of protein inclusions containing alpha-synuclein and ubiquitin (5, 6).

References: 1. “Genetics Home Reference: SNCA”. US National Library of Medicine. (2013).2. Zhang L., et al. (2008) Brain Res. 1244: 40-52.3. Alim M.A., et al. (2002) J Biol Chem. 277(3): 2112-2117.4. Kokhan V.S., Afanasyeva M.A., Van'kin G. (2012) Behav. Brain. Res. 231(1): 226-230.5. Spillantini M.G., et al. (1997) Nature. 388(6645): 839-840.6. Mezey E., et al. (1998) Nat Med. 4(7): 755-757.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
More Information
SKU STRSPR-322E-A594
Manufacturer Stressmarq Biosciences
Manufacturer SKU SPR-322E-A594
Green Labware No
Package Unit 100 µg x5
Quantity Unit PAK
Reactivity Human
Application Western Blotting, In Vivo Assay, SDS-PAGE
Human Gene ID 6622
Product information (PDF)
×
MSDS (PDF) Download