ACTL6B Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL6B

Key Reference: Oma,Y., (2003) Biochem. Biophys. Res. Commun. 301 (2), 521-528

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: GHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-like protein 6B

Protein Size: 426

Purification: Affinity Purified

• SKU: AVIARP56847_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56847_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51412
• Host: Rabbit