ACTR3B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3B

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-related protein 3B

Protein Size: 418

Purification: Affinity Purified

• SKU: AVIARP57420_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57420_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57180
• Host: Rabbit