ACTR3B Antibody - N-terminal region : FITC

ACTR3B Antibody - N-terminal region : FITC
SKU
AVIARP57420_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3B

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-related protein 3B

Protein Size: 418

Purification: Affinity Purified
More Information
SKU AVIARP57420_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57420_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57180
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×