ADAMDEC1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation. This protein may play an important role in dendritic cell function and their i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADAMDEC1

Key Reference: 0

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADAM DEC1

Protein Size: 470

Purification: Affinity Purified

• SKU: AVIARP55070_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55070_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27299
• Host: Rabbit