AGGF1 Antibody - middle region : Biotin

AGGF1 Antibody - middle region : Biotin
SKU
AVIARP57098_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The AGGF1 gene encodes a potent angiogenic factor that contains a forkhead-associated domain and a G-patch domain (Tian et al., 2004 [PubMed 14961121]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AGGF1

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: EYEDEKTLKNPKYKDRAGKRREQVGSEGTFQRDDAPASVHSEITDSNKGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Angiogenic factor with G patch and FHA domains 1

Protein Size: 714

Purification: Affinity Purified
More Information
SKU AVIARP57098_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57098_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55109
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×