AIP Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a receptor for aryl hydrocarbons and a ligand-activated transcription factor. The encoded protein is found in the cytoplasm as part of a multiprotein complex, but upon binding of ligand is transported to the nucleus. This protein can regulate the expression of many xenobiotic metabolizing enzymes. Also, the encoded protein can bind specifically to and inhibit the activity of hepatitis B virus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AIP

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: NAQEAQADFAKVLELDPALAPVVSRELQALEARIRQKDEEDKARFRGIFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AH receptor-interacting protein

Protein Size: 330

Purification: Affinity Purified

• SKU: AVIARP58131_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58131_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9049
• Host: Rabbit