AIP Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. AIP may play a positive role in AHR-mediated signalling possibly by influencing its receptivity for ligand and/or its nuclear targeting. AIP is the cellular negative regulator of the HBV X protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AIP

Key Reference: Buchbinder,S., (er) Exp. Clin. Endocrinol. Diabetes (2008) In press

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: FHYRTLHSDDEGTVLDDSRARGKPMELIIGKKFKLPVWETIVCTMREGEI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: AH receptor-interacting protein

Protein Size: 330

Purification: Affinity Purified

• SKU: AVIARP58132_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58132_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9049
• Host: Rabbit