Ak1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ak1 catalyzes the conversion of ATP and AMP to ADP in adenine nucleotide metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ak1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Adenylate kinase isoenzyme 1

Protein Size: 194

Purification: Affinity Purified

• SKU: AVIARP54830_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54830_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 24183
• Host: Rabbit