Ak1 Antibody - middle region : HRP

Ak1 Antibody - middle region : HRP
SKU
AVIARP54830_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ak1 catalyzes the conversion of ATP and AMP to ADP in adenine nucleotide metabolism.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ak1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: TVLDMLRDAMLAKVDSSNGFLIDGYPREVKQGEEFERKIAQPTLLLYVDA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Adenylate kinase isoenzyme 1

Protein Size: 194

Purification: Affinity Purified
More Information
SKU AVIARP54830_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54830_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24183
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×