AKR7A3 Antibody - middle region : Biotin

AKR7A3 Antibody - middle region : Biotin
SKU
AVIARP54824_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human AKR7A3

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aflatoxin B1 aldehyde reductase member 3

Protein Size: 331

Purification: Affinity Purified
More Information
SKU AVIARP54824_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54824_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 22977
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×