ALDH1B1 Antibody - middle region : FITC

ALDH1B1 Antibody - middle region : FITC
SKU
AVIARP58417_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ALDH1B1 belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ALDH1B1

Key Reference: Luo,P., (2007) Stem Cells 25 (10), 2628-2637

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aldehyde dehydrogenase X, mitochondrial

Protein Size: 517

Purification: Affinity Purified
More Information
SKU AVIARP58417_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58417_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 219
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×