Aldh2 Antibody - C-terminal region : Biotin

Aldh2 Antibody - C-terminal region : Biotin
SKU
AVIARP58418_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Aldh2 is capable of converting retinaldehyde to retinoic acid.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Aldh2

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Aldehyde dehydrogenase, mitochondrial

Protein Size: 519

Purification: Affinity Purified
More Information
SKU AVIARP58418_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58418_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 11669
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×