ALDH7A1 Antibody - N-terminal region : Biotin

ALDH7A1 Antibody - N-terminal region : Biotin
SKU
AVIARP57834_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Antiquitin is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. Mutations in this gene cause pyridoxine-dependent epilepsy, which involves a combination of various seizure types and is responsive to immediate administration of pyridoxine hydrochloride. Four additional human antiquitin-like sequences, all of which are pseudogenes, have also been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALDH7A1

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Alpha-aminoadipic semialdehyde dehydrogenase

Protein Size: 511

Purification: Affinity Purified
More Information
SKU AVIARP57834_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57834_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 501
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×