ALLC Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALLC

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: VIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Allantoicase, isoform CRA_a EMBL EAX01050.1

Protein Size: 391

Purification: Affinity Purified

• SKU: AVIARP57249_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57249_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55821
• Host: Rabbit