Ambp Antibody - C-terminal region : Biotin

Ambp Antibody - C-terminal region : Biotin
SKU
AVIARP59162_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.


Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein AMBP

Protein Size: 349

Purification: Affinity Purified
More Information
SKU AVIARP59162_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59162_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25377
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×