Ambp Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.


Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein AMBP

Protein Size: 349

Purification: Affinity Purified

• SKU: AVIARP59162_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59162_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 25377
• Host: Rabbit