AMBP Antibody - N-terminal region : FITC

AMBP Antibody - N-terminal region : FITC
SKU
AVIARP59163_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMBP

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: VCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein AMBP

Protein Size: 352

Purification: Affinity Purified
More Information
SKU AVIARP59163_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59163_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 259
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×