AMD1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMD1

Key Reference: Guidotti,A., (2007) Neuroreport 18 (1), 57-60

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: S-adenosylmethionine decarboxylase proenzyme

Protein Size: 186

Purification: Affinity Purified

• SKU: AVIARP54480_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54480_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 262
• Host: Rabbit