AMELY Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in a related gene on chromosome X cause X-linked amelogenesis imperfecta.

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: QPMQPQPPVQPMQPLLPQPPLPPMFPLRPLPPILPDLHLEAWPATDKTKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amelogenin, Y isoform

Protein Size: 192

Purification: Affinity Purified

• SKU: AVIARP54565_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54565_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 266
• Host: Rabbit