Amigo2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Amigo2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. It also may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphoterin-induced protein 2

Protein Size: 520

Purification: Affinity Purified

• SKU: AVIARP55810_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55810_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 300186
• Host: Rabbit