AMIGO2 Antibody - N-terminal region : Biotin

AMIGO2 Antibody - N-terminal region : Biotin
SKU
AVIARP55809_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: AMIGO2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3 abd may contribute to signal transduction through its intracellular domain. It also may be required for tumorigenesis of a subset of gastric adenocarcinomas.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human AMIGO2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphoterin-induced protein 2

Protein Size: 522

Purification: Affinity Purified
More Information
SKU AVIARP55809_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55809_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 347902
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×