AMIGO3 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: AMIGO3 may mediate heterophilic cell-cell interaction. AMIGO3 may contribute to signal transduction through its intracellular domain.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMIGO3

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWLVLLGTLLCMLRVGLGTPDSEGFPPRALHNCPYKCICAADLLSCTGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amphoterin-induced protein 3

Protein Size: 504

Purification: Affinity Purified

• SKU: AVIARP55919_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55919_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Guinea Pig
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 386724
• Host: Rabbit