AMN1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: AMN1 belongs to the AMN1 family. The exact function of AMN1 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMN1

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: PRPRRVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQIT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein AMN1 homolog

Protein Size: 258

Purification: Affinity Purified

• SKU: AVIARP54560_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54560_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 196394
• Host: Rabbit