Amz2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Amz2 is Zinc metalloprotease. It exhibits activity against angiotensin-3 in vitro and does not hydrolyze neurogranin nor angiotensin-2.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Amz2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITLHSQSDWISSHPEAPQDFEQFFSDRYRKAPCPKKHIIYIQPIGFLGNT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Archaemetzincin-2

Protein Size: 359

Purification: Affinity Purified

• SKU: AVIARP56247_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56247_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 360650
• Host: Rabbit